PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000198108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 235aa    MW: 27019.5 Da    PI: 6.5176
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000198108genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM127.98.1e-40231512128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                     p +rF+Ptde lv++yL+ k++g++  + ++i+e+d++k+eP dLp    + +ekew+fFs+ d ky +++r nrat++g+ k tgk++e+ ++ 
  MDP0000198108  23 LPSVRFKPTDELLVSYYLRSKIQGTDSLFRHTIPEIDVCKYEPCDLPaFFPEDHEKEWFFFSRPDYKYINSTRCNRATDQGFYKITGKEREIRAEe 118
                    6899**********************888788***************445566788*************************************985 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++++g k++L+fy+gr pk++ktdWv+hey l
  MDP0000198108 119 SKAVIGKKRILTFYEGRVPKSKKTDWVVHEYYL 151
                    66779**************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-4217174IPR003441NAC domain
PROSITE profilePS5100543.68722174IPR003441NAC domain
PfamPF023653.4E-1924150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MSSSSSSITT EGGDAVHANV ILLPSVRFKP TDELLVSYYL RSKIQGTDSL FRHTIPEIDV  60
CKYEPCDLPA FFPEDHEKEW FFFSRPDYKY INSTRCNRAT DQGFYKITGK EREIRAEESK  120
AVIGKKRILT FYEGRVPKSK KTDWVVHEYY LTKIEVGSRP TKQMDFVLWR LKNKSASYKK  180
PKDDPIHGEL ADSGANSEDD QAAVSDVIAE PVEHLGYFFD NLQIETLISS KYCFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-292218017171NO APICAL MERISTEM PROTEIN
1ut4_B5e-292218017171NO APICAL MERISTEM PROTEIN
1ut7_A5e-292218017171NO APICAL MERISTEM PROTEIN
1ut7_B5e-292218017171NO APICAL MERISTEM PROTEIN
4dul_A5e-292218017171NAC domain-containing protein 19
4dul_B5e-292218017171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.140820.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF9687650.0HF968765.1 Malus x domestica metacontig of the Co-Gene region, cultivar Procats28, columnar allele.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347728.11e-176PREDICTED: protein FEZ-like
TrEMBLM5X4Q72e-91M5X4Q7_PRUPE; Uncharacterized protein
TrEMBLM5X7M18e-92M5X7M1_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s00760.15e-39(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13710524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.11e-41NAC transcription factor-like 9